PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G016600.1.p
Common NameSb09g001590, SORBIDRAFT_09g001590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 335aa    MW: 36212.5 Da    PI: 7.897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G016600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-1554101148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           +g+WT+eEd +lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  Sobic.009G016600.1.p  54 KGPWTEEEDAQLVWFVRLFGERRWDFLAKVSGLRRTGKSCRLRWVNYL 101
                           79********************************************97 PP

2Myb_DNA-binding49.97.1e-16107150146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rgr T++E+ l++++++q+G++ W++Iar ++ gRt++++k++w++
  Sobic.009G016600.1.p 107 RGRITADEERLILQLHEQWGSR-WSRIARSLP-GRTDNEIKNFWRT 150
                           899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0149101IPR017930Myb domain
SuperFamilySSF466897.35E-2852148IPR009057Homeodomain-like
SMARTSM007173.1E-1353103IPR001005SANT/Myb domain
PfamPF002491.7E-1354101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2055108IPR009057Homeodomain-like
CDDcd001672.13E-1056101No hitNo description
PROSITE profilePS5129422.724102156IPR017930Myb domain
SMARTSM007171.2E-13106154IPR001005SANT/Myb domain
PfamPF002491.3E-13107150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-21109154IPR009057Homeodomain-like
CDDcd001677.83E-11111150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDDHLHHQLM ATPAAAAASM CGSKSKKLQG GGGGEHRSSR GSGGGNSPPA AMRKGPWTEE  60
EDAQLVWFVR LFGERRWDFL AKVSGLRRTG KSCRLRWVNY LHPGLRRGRI TADEERLILQ  120
LHEQWGSRWS RIARSLPGRT DNEIKNFWRT RARKQKAAAQ QQQGSRSSKT ASAFSGSSSS  180
SSVTATTSRS SCSGSPSPSP SPSSGGCGGT ATTSSSAVTE SALRQSSGGD NDDEDAELDE  240
ASTTTAARQH QYHHQQQQQE CYASDHFFWN DIAAAEAASY MFIDGLAGAG PGGHPATAEV  300
GAEPPSSPTW EYCSDYSLWR IDDNEYYKKM LDSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-26541554104C-Myb DNA-Binding Domain
1mse_C4e-26541554104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.178110.0callus| leaf| root| shoot
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283601e-118KJ728360.1 Zea mays clone pUT6642 MYB transcription factor (MYB62) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439162.10.0hypothetical protein SORBIDRAFT_09g001590
TrEMBLC5YYM10.0C5YYM1_SORBI; Putative uncharacterized protein Sb09g001590
STRINGSb09g001590.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-53myb domain protein 59